PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID KHN31844.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Fabales; Fabaceae; Papilionoideae; Phaseoleae; Glycine; Soja
Family HSF
Protein Properties Length: 129aa    MW: 14549.9 Da    PI: 6.0623
Description HSF family protein
Gene Model
Gene Model ID Type Source Coding Sequence
KHN31844.1genomeTCUHKView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1HSF_DNA-bind62.51.1e-1967126160
                   HHHHHHHHHHCTGGGTTTSEESSSSSEEEES-HHHHHHHTHHHHSTT--HHHHHHHHHHT CS
  HSF_DNA-bind   1 aFlkklyeiledeelkeliswsengnsfvvldeeefakkvLpkyFkhsnfaSFvRQLnmY 60 
                   aFl+k+++ ++d++l+ ++sw  +g s++v+d++ fa++vLp  Fkh+nf+SFvRQLn+Y
    KHN31844.1  67 AFLSKTFDPVDDPSLDPIMSWCYSGVSYMVWDPTLFARHVLPMNFKHNNFSSFVRQLNTY 126
                   69*********************************************************9 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
Gene3DG3DSA:1.10.10.101.4E-2063126IPR011991Winged helix-turn-helix DNA-binding domain
SMARTSM004151.5E-1064129IPR000232Heat shock factor (HSF)-type, DNA-binding
SuperFamilySSF467852.72E-1766126IPR011991Winged helix-turn-helix DNA-binding domain
PRINTSPR000565.4E-126891IPR000232Heat shock factor (HSF)-type, DNA-binding
PfamPF004471.8E-1568126IPR000232Heat shock factor (HSF)-type, DNA-binding
PRINTSPR000565.4E-12106118IPR000232Heat shock factor (HSF)-type, DNA-binding
PRINTSPR000565.4E-12119129IPR000232Heat shock factor (HSF)-type, DNA-binding
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0005634Cellular Componentnucleus
GO:0003700Molecular Functiontranscription factor activity, sequence-specific DNA binding
GO:0043565Molecular Functionsequence-specific DNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 129 aa     Download sequence    Send to blast
MVSGSYILVL KETKFEYSEP VLYLDVGIWH PLAPISSPSC PLPVARNTIS ICLSHPLECL  60
QGNPVPAFLS KTFDPVDDPS LDPIMSWCYS GVSYMVWDPT LFARHVLPMN FKHNNFSSFV  120
RQLNTYVVI
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
1hks_A7e-1662126165HEAT-SHOCK TRANSCRIPTION FACTOR
1hkt_A7e-1662126165HEAT-SHOCK TRANSCRIPTION FACTOR
2ldu_A1e-15651261778Heat shock factor protein 1
5d5u_B1e-15651262687Heat shock factor protein 1
5d5v_B1e-15651262687Heat shock factor protein 1
5d5v_D1e-15651262687Heat shock factor protein 1
Search in ModeBase
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankBT0961333e-87BT096133.1 Soybean clone JCVI-FLGm-15K24 unknown mRNA.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_006577056.17e-40PREDICTED: heat stress transcription factor A-3-like
SwissprotQ8GYY14e-34HSFA3_ARATH; Heat stress transcription factor A-3
TrEMBLA0A0B2RHQ62e-91A0A0B2RHQ6_GLYSO; Heat stress transcription factor A-3
STRINGGLYMA03G34900.12e-39(Glycine max)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
FabidsOGEF15923395
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT5G03720.12e-35heat shock transcription factor A3
Publications ? help Back to Top
  1. Qi X, et al.
    Identification of a novel salt tolerance gene in wild soybean by whole-genome sequencing.
    Nat Commun, 2014. 5: p. 4340
    [PMID:25004933]